CDS

Accession Number TCMCG047C17826
gbkey CDS
Protein Id GFP96391.1
Location join(530189..530260,530571..530637,530929..531020,531292..531429,531522..531677)
Organism Phtheirospermum japonicum
locus_tag PHJA_001783200

Protein

Length 174aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB3858 BioSample:SAMD00029051
db_source BMAC01000436.1
Definition endonuclease iii homolog 1 chloroplastic [Phtheirospermum japonicum]
Locus_tag PHJA_001783200

EGGNOG-MAPPER Annotation

COG_category L
Description Bifunctional DNA N-glycosylase with associated apurinic apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N- glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko03400        [VIEW IN KEGG]
KEGG_ko ko:K10773        [VIEW IN KEGG]
EC 4.2.99.18        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko03410        [VIEW IN KEGG]
map03410        [VIEW IN KEGG]
GOs GO:0000702        [VIEW IN EMBL-EBI]
GO:0000703        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0003906        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005911        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006259        [VIEW IN EMBL-EBI]
GO:0006281        [VIEW IN EMBL-EBI]
GO:0006284        [VIEW IN EMBL-EBI]
GO:0006285        [VIEW IN EMBL-EBI]
GO:0006289        [VIEW IN EMBL-EBI]
GO:0006296        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006479        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006974        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008168        [VIEW IN EMBL-EBI]
GO:0008170        [VIEW IN EMBL-EBI]
GO:0008213        [VIEW IN EMBL-EBI]
GO:0008276        [VIEW IN EMBL-EBI]
GO:0008757        [VIEW IN EMBL-EBI]
GO:0009295        [VIEW IN EMBL-EBI]
GO:0009506        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016278        [VIEW IN EMBL-EBI]
GO:0016279        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016741        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016798        [VIEW IN EMBL-EBI]
GO:0016799        [VIEW IN EMBL-EBI]
GO:0018022        [VIEW IN EMBL-EBI]
GO:0018193        [VIEW IN EMBL-EBI]
GO:0018205        [VIEW IN EMBL-EBI]
GO:0019104        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0030054        [VIEW IN EMBL-EBI]
GO:0032259        [VIEW IN EMBL-EBI]
GO:0033554        [VIEW IN EMBL-EBI]
GO:0033683        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042644        [VIEW IN EMBL-EBI]
GO:0042646        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0043414        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051716        [VIEW IN EMBL-EBI]
GO:0055044        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0090305        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:0140097        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAGGTCTTCTGAAGATGCACCCGTCGATTCAATGGGCTGTGAAAAAGCTGGCACTTCCCTTCCTCCTAAGGAAAGAAGATTCGCGGTTTTGGTATCGTCACTCTTGTCAAGCCAAACGAAGGATAACGTTACTCATGGAGCTATTCAACGGCTGCTTCAAAATGATTTGCTTACAGCTGAAGCCATTGACAAAGCCAATGAAGATGAAATCAAGGAATTAATTTACCCAGTGGGATTTTACACAAGAAAAGCAAGCAACATGAAAAAAATTGCGAAAATTTGTCTGTTAAAGTATGATGGAGATATTCCGAGTACGTTACAGGGTTTGCTCGAGCTTCCCGGCATCGGCCCGAAAATGGCTCATTTGGTAATGAATGTAGGGTGGGATAATGTTCAAGGAATATGTGTAGACACGCACGTGCACCGGATTAGTAATCGGCTCGCATGGGTTTCACGTCCCGGCACTAAGCAGGTACACTTCAATTACAAAAAAGACCTAAAGCTTTTTTTTTTTTTAACTTGA
Protein:  
MRSSEDAPVDSMGCEKAGTSLPPKERRFAVLVSSLLSSQTKDNVTHGAIQRLLQNDLLTAEAIDKANEDEIKELIYPVGFYTRKASNMKKIAKICLLKYDGDIPSTLQGLLELPGIGPKMAHLVMNVGWDNVQGICVDTHVHRISNRLAWVSRPGTKQVHFNYKKDLKLFFFLT